Lineage for d4n60b_ (4n60 B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646108Species Influenza A virus [TaxId:1332244] [256359] (11 PDB entries)
  8. 2646137Domain d4n60b_: 4n60 B: [240565]
    Other proteins in same PDB: d4n60a_, d4n60c_
    automated match to d4n5zb_
    complexed with nag

Details for d4n60b_

PDB Entry: 4n60 (more details), 2.9 Å

PDB Description: crystal structure of hemagglutinin from an h7n9 influenza virus in complex with lstc
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d4n60b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n60b_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 1332244]}
gaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqf
elidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervk
rqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriq

SCOPe Domain Coordinates for d4n60b_:

Click to download the PDB-style file with coordinates for d4n60b_.
(The format of our PDB-style files is described here.)

Timeline for d4n60b_: