Lineage for d4n5kb_ (4n5k B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2267375Protein automated matches [254646] (34 species)
    not a true protein
  7. 2267566Species Influenza a virus [TaxId:1332244] [256359] (9 PDB entries)
  8. 2267589Domain d4n5kb_: 4n5k B: [240563]
    Other proteins in same PDB: d4n5ka_, d4n5kc_
    automated match to d4n5zb_
    complexed with nag, sia

Details for d4n5kb_

PDB Entry: 4n5k (more details), 2.71 Å

PDB Description: crystal structure of hemagglutinin from an h7n9 influenza virus in complex with lsta
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d4n5kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n5kb_ h.3.1.1 (B:) automated matches {Influenza a virus [TaxId: 1332244]}
gaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqf
elidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervk
rqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriq

SCOPe Domain Coordinates for d4n5kb_:

Click to download the PDB-style file with coordinates for d4n5kb_.
(The format of our PDB-style files is described here.)

Timeline for d4n5kb_: