Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (33 species) not a true protein |
Species Influenza a virus [TaxId:1332244] [256359] (9 PDB entries) |
Domain d4n5kb_: 4n5k B: [240563] Other proteins in same PDB: d4n5ka_, d4n5kc_ automated match to d4n5zb_ complexed with nag, sia |
PDB Entry: 4n5k (more details), 2.71 Å
SCOPe Domain Sequences for d4n5kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n5kb_ h.3.1.1 (B:) automated matches {Influenza a virus [TaxId: 1332244]} gaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqf elidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervk rqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriq
Timeline for d4n5kb_: