SCOPe 2.04: Domain d4n5jd_: 4n5j D:

Lineage for d4n5jd_ (4n5j D:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (27 species)
   not a true protein

7. Species Influenza a virus [TaxId:1332244] [256359] (9 PDB entries)

8. Domain d4n5jd_: 4n5j D: [240562]
   Other proteins in same PDB: d4n5ja_, d4n5jc_
   automated match to d4n5zb_
   complexed with nag

Details for d4n5jd_

PDB Entry: 4n5j, 2.7 Å

PDB Description: crystal structure of hemagglutinin from an h7n9 influenza virus

PDB Compounds: (D:) hemagglutinin HA2

SCOPe Domain Sequences for d4n5jd_:

Sequence; same for both SEQRES and ATOM records:

>d4n5jd_ h.3.1.1 (D:) automated matches {Influenza a virus [TaxId: 1332244]}
fiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfelidn
efnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkrqlre
naeedgtgcfeifhkcdddcmasirnntydhskyreeamqn

Timeline for d4n5jd_:

• d4n5jd_ is new in SCOPe 2.04-stable
  
• d4n5jd_ appears in SCOPe 2.05
  
• d4n5jd_ appears in the current release, SCOPe 2.08