Lineage for d4n1yb_ (4n1y B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2343011Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2343012Protein automated matches [191142] (6 species)
    not a true protein
  7. 2343013Species Crassostrea gigas [TaxId:29159] [226087] (2 PDB entries)
  8. 2343019Domain d4n1yb_: 4n1y B: [240560]

Details for d4n1yb_

PDB Entry: 4n1y (more details), 2.61 Å

PDB Description: crystal structure of the pacific oyster estrogen receptor ligand binding domain
PDB Compounds: (B:) Estrogen receptor

SCOPe Domain Sequences for d4n1yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n1yb_ a.123.1.0 (B:) automated matches {Crassostrea gigas [TaxId: 29159]}
qtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvpgytdl
slsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteifeqvaa
vseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqkyhpdnv
rhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaqd

SCOPe Domain Coordinates for d4n1yb_:

Click to download the PDB-style file with coordinates for d4n1yb_.
(The format of our PDB-style files is described here.)

Timeline for d4n1yb_: