Lineage for d4n1ya_ (4n1y A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1748271Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 1748272Protein automated matches [191142] (5 species)
    not a true protein
  7. 1748273Species Crassostrea gigas [TaxId:29159] [226087] (1 PDB entry)
  8. 1748274Domain d4n1ya_: 4n1y A: [240559]

Details for d4n1ya_

PDB Entry: 4n1y (more details), 2.6 Å

PDB Description: crystal structure of the pacific oyster estrogen receptor ligand binding domain
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d4n1ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n1ya_ a.123.1.0 (A:) automated matches {Crassostrea gigas [TaxId: 29159]}
qtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvpgytdl
slsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteifeqvaa
vseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqkyhpdnv
rhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaq

SCOPe Domain Coordinates for d4n1ya_:

Click to download the PDB-style file with coordinates for d4n1ya_.
(The format of our PDB-style files is described here.)

Timeline for d4n1ya_: