Lineage for d1wbld_ (1wbl D:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371124Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 371251Protein Legume lectin [49904] (23 species)
  7. 371505Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (2 PDB entries)
  8. 371511Domain d1wbld_: 1wbl D: [24055]
    complexed with amg, ca, fuc, mn, nag

Details for d1wbld_

PDB Entry: 1wbl (more details), 2.5 Å

PDB Description: winged bean lectin complexed with methyl-alpha-d-galactose

SCOP Domain Sequences for d1wbld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbld_ b.29.1.1 (D:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOP Domain Coordinates for d1wbld_:

Click to download the PDB-style file with coordinates for d1wbld_.
(The format of our PDB-style files is described here.)

Timeline for d1wbld_: