Lineage for d4mwsb_ (4mws B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2474966Family c.69.1.5: Serine carboxypeptidase-like [53499] (4 protein domains)
    automatically mapped to Pfam PF00450
  6. 2474990Protein automated matches [190105] (2 species)
    not a true protein
  7. 2474993Species Human (Homo sapiens) [TaxId:9606] [237661] (1 PDB entry)
  8. 2474995Domain d4mwsb_: 4mws B: [240546]
    automated match to d4mwsa_
    complexed with bma, fuc, gol, man, nag

Details for d4mwsb_

PDB Entry: 4mws (more details), 2.8 Å

PDB Description: crystal structure of human ppca (trigonal crystal form 1)
PDB Compounds: (B:) lysosomal protective protein

SCOPe Domain Sequences for d4mwsb_:

Sequence, based on SEQRES records: (download)

>d4mwsb_ c.69.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apdqdeiqrlpglakqpsfrqysgylkgsgskhlhywfvesqkdpenspvvlwlnggpgc
ssldglltehgpflvqpdgvtleynpyswnlianvlylespagvgfsysddkfyatndte
vaqsnfealqdffrlfpeyknnklfltgesyagiyiptlavlvmqdpsmnlqglavgngl
ssyeqndnslvyfayyhgllgnrlwsslqthccsqnkcnfydnkdlecvtnlqevarivg
nsglniynlyapcaggvpshfrsgdkvrmdppctnttaastylnnpyvrkalnipeqlpq
wdmcnflvnlqyrrlyrsmnsqylkllssqkyqillyngdvdmacnfmgdewfvdslnqk
mevqrrpwlvkygdsgeqiagfvkefshiafltikgaghmvptdkplaaftmfsrflnkq
py

Sequence, based on observed residues (ATOM records): (download)

>d4mwsb_ c.69.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apdqdeiqrlpglakqpsfrqysgylkgsgskhlhywfvesqkdpenspvvlwlnggpgc
ssldglltehgpflvqpdgvtleynpyswnlianvlylespagvgfsysddkfyatndte
vaqsnfealqdffrlfpeyknnklfltgesyagiyiptlavlvmqdpsmnlqglavgngl
ssyeqndnslvyfayyhgllgnrlwsslqthccsqnkcnfydnkdlecvtnlqevarivg
nsglniynlyapcaggvprmdppctnttaastylnnpyvrkalnipeqlpqwdmcnflvn
lqyrrlyrsmnsqylkllssqkyqillyngdvdmacnfmgdewfvdslnqkmevqrrpwl
vkygdsgeqiagfvkefshiafltikgaghmvptdkplaaftmfsrflnkqpy

SCOPe Domain Coordinates for d4mwsb_:

Click to download the PDB-style file with coordinates for d4mwsb_.
(The format of our PDB-style files is described here.)

Timeline for d4mwsb_: