Lineage for d4mhij_ (4mhi J:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709417Protein Influenza hemagglutinin (stalk) [58066] (7 species)
    trimer
  7. 1709420Species Influenza A virus, different strains [TaxId:11320] [58067] (95 PDB entries)
  8. 1709553Domain d4mhij_: 4mhi J: [240540]
    Other proteins in same PDB: d4mhia_, d4mhic_, d4mhie_, d4mhig_, d4mhii_, d4mhik_, d4mhim_, d4mhio_, d4mhiq_
    automated match to d4n5zb_
    complexed with nag

Details for d4mhij_

PDB Entry: 4mhi (more details), 2.6 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin from a/goose/guangdong/1/96
PDB Compounds: (J:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4mhij_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mhij_ h.3.1.1 (J:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreei

SCOPe Domain Coordinates for d4mhij_:

Click to download the PDB-style file with coordinates for d4mhij_.
(The format of our PDB-style files is described here.)

Timeline for d4mhij_: