SCOPe 2.06: Domain d1wblc_: 1wbl C:

Lineage for d1wblc_ (1wbl C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries)

8. Domain d1wblc_: 1wbl C: [24054]
   complexed with amg, ca, mn

Details for d1wblc_

PDB Entry: 1wbl, 2.5 Å

PDB Description: winged bean lectin complexed with methyl-alpha-d-galactose

PDB Compounds: (C:) winged bean lectin

SCOPe Domain Sequences for d1wblc_:

Sequence; same for both SEQRES and ATOM records:

>d1wblc_ b.29.1.1 (C:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

Timeline for d1wblc_:

• d1wblc_ first appeared (with stable ids) in SCOP 1.55
  
• d1wblc_ appears in SCOPe 2.05
  
• d1wblc_ appears in SCOPe 2.07
  
• d1wblc_ appears in the current release, SCOPe 2.08