Lineage for d1wblc_ (1wbl C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 943756Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 943894Protein Legume lectin [49904] (23 species)
  7. 944200Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries)
  8. 944217Domain d1wblc_: 1wbl C: [24054]
    complexed with amg, ca, mn

Details for d1wblc_

PDB Entry: 1wbl (more details), 2.5 Å

PDB Description: winged bean lectin complexed with methyl-alpha-d-galactose
PDB Compounds: (C:) winged bean lectin

SCOPe Domain Sequences for d1wblc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wblc_ b.29.1.1 (C:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOPe Domain Coordinates for d1wblc_:

Click to download the PDB-style file with coordinates for d1wblc_.
(The format of our PDB-style files is described here.)

Timeline for d1wblc_: