Lineage for d1wblc_ (1wbl C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57551Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 57552Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 57553Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 57658Protein Legume lectin [49904] (18 species)
  7. 57827Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (2 PDB entries)
  8. 57832Domain d1wblc_: 1wbl C: [24054]

Details for d1wblc_

PDB Entry: 1wbl (more details), 2.5 Å

PDB Description: winged bean lectin complexed with methyl-alpha-d-galactose

SCOP Domain Sequences for d1wblc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wblc_ b.29.1.1 (C:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOP Domain Coordinates for d1wblc_:

Click to download the PDB-style file with coordinates for d1wblc_.
(The format of our PDB-style files is described here.)

Timeline for d1wblc_: