SCOPe 2.07: Domain d4mhih_: 4mhi H:

Lineage for d4mhih_ (4mhi H:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (17 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries)

8. Domain d4mhih_: 4mhi H: [240539]
   Other proteins in same PDB: d4mhia1, d4mhia2, d4mhic1, d4mhic2, d4mhie1, d4mhie2, d4mhig1, d4mhig2, d4mhii1, d4mhii2, d4mhik1, d4mhik2, d4mhim1, d4mhim2, d4mhio1, d4mhio2, d4mhiq1, d4mhiq2
   automated match to d4n5zb_
   complexed with nag

Details for d4mhih_

PDB Entry: 4mhi, 2.6 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin from a/goose/guangdong/1/96

PDB Compounds: (H:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4mhih_:

Sequence; same for both SEQRES and ATOM records:

>d4mhih_ h.3.1.1 (H:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreei

Timeline for d4mhih_:

• d4mhih_ first appeared in SCOPe 2.04
  
• d4mhih_ appears in SCOPe 2.06
  
• d4mhih_ appears in the current release, SCOPe 2.08