Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (7 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (95 PDB entries) |
Domain d4mhih_: 4mhi H: [240539] Other proteins in same PDB: d4mhia_, d4mhic_, d4mhie_, d4mhig_, d4mhii_, d4mhik_, d4mhim_, d4mhio_, d4mhiq_ automated match to d4n5zb_ complexed with nag |
PDB Entry: 4mhi (more details), 2.6 Å
SCOPe Domain Sequences for d4mhih_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mhih_ h.3.1.1 (H:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreei
Timeline for d4mhih_: