Lineage for d4mhif_ (4mhi F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041150Domain d4mhif_: 4mhi F: [240538]
    Other proteins in same PDB: d4mhia1, d4mhia2, d4mhic1, d4mhic2, d4mhie1, d4mhie2, d4mhig1, d4mhig2, d4mhii1, d4mhii2, d4mhik1, d4mhik2, d4mhim1, d4mhim2, d4mhio1, d4mhio2, d4mhiq1, d4mhiq2
    automated match to d4n5zb_
    complexed with nag

Details for d4mhif_

PDB Entry: 4mhi (more details), 2.6 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin from a/goose/guangdong/1/96
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4mhif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mhif_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreei

SCOPe Domain Coordinates for d4mhif_:

Click to download the PDB-style file with coordinates for d4mhif_.
(The format of our PDB-style files is described here.)

Timeline for d4mhif_: