Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 proteins) fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomain |
Protein automated matches [196235] (1 species) not a true protein |
Species Haemophilus influenzae [TaxId:71421] [196236] (7 PDB entries) |
Domain d4mcbb_: 4mcb B: [240533] automated match to d1uaja_ protein/RNA complex; complexed with 21w, act, gol, so4 |
PDB Entry: 4mcb (more details), 1.94 Å
SCOPe Domain Sequences for d4mcbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mcbb_ c.116.1.4 (B:) automated matches {Haemophilus influenzae [TaxId: 71421]} mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide rliqteideewsigdyvltggelpamtlidavarfipgvlgkqasaeedsfadglldcph ytrpevlegltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkea qae
Timeline for d4mcbb_: