Lineage for d4mcbb_ (4mcb B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1629957Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 1629958Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 1630021Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 proteins)
    fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomain
  6. 1630034Protein automated matches [196235] (1 species)
    not a true protein
  7. 1630035Species Haemophilus influenzae [TaxId:71421] [196236] (4 PDB entries)
  8. 1630038Domain d4mcbb_: 4mcb B: [240533]
    automated match to d1uaja_
    protein/RNA complex; complexed with 21w, act, gol, so4

Details for d4mcbb_

PDB Entry: 4mcb (more details), 1.94 Å

PDB Description: h.influenzae trmd in complex with n-(4-{[(1h-imidazol-2-ylmethyl)amino]methyl}benzyl)-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidine-5-carboxamide
PDB Compounds: (B:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d4mcbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mcbb_ c.116.1.4 (B:) automated matches {Haemophilus influenzae [TaxId: 71421]}
mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
rliqteideewsigdyvltggelpamtlidavarfipgvlgkqasaeedsfadglldcph
ytrpevlegltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkea
qae

SCOPe Domain Coordinates for d4mcbb_:

Click to download the PDB-style file with coordinates for d4mcbb_.
(The format of our PDB-style files is described here.)

Timeline for d4mcbb_: