| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
| Protein automated matches [254645] (42 species) not a true protein |
| Species Influenza A virus, different strains [TaxId:11320] [255657] (9 PDB entries) |
| Domain d4mc5c2: 4mc5 C:332-503 [240532] Other proteins in same PDB: d4mc5a1, d4mc5a2, d4mc5b1, d4mc5b2, d4mc5c1, d4mc5c3 automated match to d1ha0a2 complexed with fuc, nag |
PDB Entry: 4mc5 (more details), 2.24 Å
SCOPe Domain Sequences for d4mc5c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mc5c2 h.3.1.0 (C:332-503) automated matches {Influenza A virus, different strains [TaxId: 11320]}
fgaiagfieggwqglidgwygyhhqnsegsgyaadkeatqkavdaittkvnniidkmntq
festakefnkiemrikhlsdrvddgfldvwsynaellvllenertldfhdanvnnlyqkv
kvqlkdnaidmgngcfkilhkcnntcmddikngtynyyeyrkeshlekqkid
Timeline for d4mc5c2:
View in 3DDomains from other chains: (mouse over for more information) d4mc5a1, d4mc5a2, d4mc5b1, d4mc5b2 |