Lineage for d4mc5c2 (4mc5 C:332-505)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709924Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 1709925Protein automated matches [254645] (6 species)
    not a true protein
  7. 1709945Species Influenza A virus [TaxId:11320] [255657] (3 PDB entries)
  8. 1709946Domain d4mc5c2: 4mc5 C:332-505 [240532]
    Other proteins in same PDB: d4mc5a1, d4mc5b1, d4mc5c1
    automated match to d1ha0a2
    complexed with fuc, nag

Details for d4mc5c2

PDB Entry: 4mc5 (more details), 2.24 Å

PDB Description: Crystal structure of a subtype H18 hemagglutinin homologue from A/flat-faced bat/Peru/033/2010 (H18N11)
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4mc5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mc5c2 h.3.1.0 (C:332-505) automated matches {Influenza A virus [TaxId: 11320]}
fgaiagfieggwqglidgwygyhhqnsegsgyaadkeatqkavdaittkvnniidkmntq
festakefnkiemrikhlsdrvddgfldvwsynaellvllenertldfhdanvnnlyqkv
kvqlkdnaidmgngcfkilhkcnntcmddikngtynyyeyrkeshlekqkidsg

SCOPe Domain Coordinates for d4mc5c2:

Click to download the PDB-style file with coordinates for d4mc5c2.
(The format of our PDB-style files is described here.)

Timeline for d4mc5c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mc5c1