Lineage for d4mc5c2 (4mc5 C:332-503)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3042016Species Influenza A virus, different strains [TaxId:11320] [255657] (9 PDB entries)
  8. 3042023Domain d4mc5c2: 4mc5 C:332-503 [240532]
    Other proteins in same PDB: d4mc5a1, d4mc5a2, d4mc5b1, d4mc5b2, d4mc5c1, d4mc5c3
    automated match to d1ha0a2
    complexed with fuc, nag

Details for d4mc5c2

PDB Entry: 4mc5 (more details), 2.24 Å

PDB Description: crystal structure of a subtype h18 hemagglutinin homologue from a/flat-faced bat/peru/033/2010 (h18n11)
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4mc5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mc5c2 h.3.1.0 (C:332-503) automated matches {Influenza A virus, different strains [TaxId: 11320]}
fgaiagfieggwqglidgwygyhhqnsegsgyaadkeatqkavdaittkvnniidkmntq
festakefnkiemrikhlsdrvddgfldvwsynaellvllenertldfhdanvnnlyqkv
kvqlkdnaidmgngcfkilhkcnntcmddikngtynyyeyrkeshlekqkid

SCOPe Domain Coordinates for d4mc5c2:

Click to download the PDB-style file with coordinates for d4mc5c2.
(The format of our PDB-style files is described here.)

Timeline for d4mc5c2: