| Class b: All beta proteins [48724] (178 folds) |
| Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
| Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
| Protein automated matches [227017] (57 species) not a true protein |
| Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries) |
| Domain d4mc5c1: 4mc5 C:4-326 [240531] Other proteins in same PDB: d4mc5a2, d4mc5b2, d4mc5c2, d4mc5c3 automated match to d1ha0a1 complexed with fuc, nag |
PDB Entry: 4mc5 (more details), 2.24 Å
SCOPe Domain Sequences for d4mc5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mc5c1 b.19.1.0 (C:4-326) automated matches {Influenza A virus, different strains [TaxId: 11320]}
gdqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcslpa
wlmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkekiidm
trfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgvhqt
snaaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqnfsi
vstgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqnaig
dcpkyvkaqelvlatglrnnpik
Timeline for d4mc5c1:
View in 3DDomains from other chains: (mouse over for more information) d4mc5a1, d4mc5a2, d4mc5b1, d4mc5b2 |