SCOPe 2.04: Domain d4mc5c1: 4mc5 C:4-326

Lineage for d4mc5c1 (4mc5 C:4-326)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (14 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [228462] (9 PDB entries)

8. Domain d4mc5c1: 4mc5 C:4-326 [240531]
   Other proteins in same PDB: d4mc5c2
   automated match to d1ha0a1
   complexed with fuc, nag

Details for d4mc5c1

PDB Entry: 4mc5, 2.24 Å

PDB Description: crystal structure of a subtype h18 hemagglutinin homologue from a/flat-faced bat/peru/033/2010 (h18n11)

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4mc5c1:

Sequence; same for both SEQRES and ATOM records:

>d4mc5c1 b.19.1.0 (C:4-326) automated matches {Influenza A virus [TaxId: 11320]}
gdqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcslpa
wlmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkekiidm
trfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgvhqt
snaaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqnfsi
vstgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqnaig
dcpkyvkaqelvlatglrnnpik

Timeline for d4mc5c1:

• d4mc5c1 is new in SCOPe 2.04-stable
  
• d4mc5c1 appears in SCOPe 2.05
  
• d4mc5c1 appears in the current release, SCOPe 2.08