Lineage for d4mc5c1 (4mc5 C:4-326)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776662Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)
  8. 2776680Domain d4mc5c1: 4mc5 C:4-326 [240531]
    Other proteins in same PDB: d4mc5a2, d4mc5b2, d4mc5c2, d4mc5c3
    automated match to d1ha0a1
    complexed with fuc, nag

Details for d4mc5c1

PDB Entry: 4mc5 (more details), 2.24 Å

PDB Description: crystal structure of a subtype h18 hemagglutinin homologue from a/flat-faced bat/peru/033/2010 (h18n11)
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4mc5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mc5c1 b.19.1.0 (C:4-326) automated matches {Influenza A virus, different strains [TaxId: 11320]}
gdqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcslpa
wlmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkekiidm
trfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgvhqt
snaaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqnfsi
vstgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqnaig
dcpkyvkaqelvlatglrnnpik

SCOPe Domain Coordinates for d4mc5c1:

Click to download the PDB-style file with coordinates for d4mc5c1.
(The format of our PDB-style files is described here.)

Timeline for d4mc5c1: