SCOPe 2.08: Domain d4ma1c2: 4ma1 C:108-214

Lineage for d4ma1c2 (4ma1 C:108-214)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d4ma1c2: 4ma1 C:108-214 [240528]
Other proteins in same PDB: d4ma1b_, d4ma1c1, d4ma1e_, d4ma1f1, d4ma1h_, d4ma1l1
automated match to d4ma1l2
complexed with k, peg

Details for d4ma1c2

PDB Entry: 4ma1 (more details), 2.32 Å

PDB Description: unliganded 3 crystal structure of s25-26 fab

PDB Compounds: (C:) S25-26 Fab (Igg1k) Light Chain

SCOPe Domain Sequences for d4ma1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ma1c2 b.1.1.2 (C:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d4ma1c2:

Click to download the PDB-style file with coordinates for d4ma1c2.
(The format of our PDB-style files is described here.)

Timeline for d4ma1c2: