SCOPe 2.04: Domain d4m4yf_: 4m4y F:

Lineage for d4m4yf_ (4m4y F:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (27 species)
   not a true protein

7. Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries)

8. Domain d4m4yf_: 4m4y F: [240520]
   Other proteins in same PDB: d4m4ya_, d4m4yc_, d4m4ye_
   automated match to d4n5zb_
   complexed with nag; mutant

Details for d4m4yf_

PDB Entry: 4m4y, 2.2 Å

PDB Description: crystal structure of a 2009 h1n1 influenza virus hemagglutinin with a stabilization mutation ha2 e47g

PDB Compounds: (F:) Hemagglutinin HA2 subunit

SCOPe Domain Sequences for d4m4yf_:

Sequence; same for both SEQRES and ATOM records:

>d4m4yf_ h.3.1.1 (F:) automated matches {Influenza A virus [TaxId: 641501]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaidgitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnre

Timeline for d4m4yf_:

• d4m4yf_ is new in SCOPe 2.04-stable
  
• d4m4yf_ appears in SCOPe 2.05
  
• d4m4yf_ appears in the current release, SCOPe 2.08