SCOP 1.73: Domain d1wbla_: 1wbl A:

Lineage for d1wbla_ (1wbl A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (9 PDB entries)

8. Domain d1wbla_: 1wbl A: [24052]

Details for d1wbla_

PDB Entry: 1wbl, 2.5 Å

PDB Description: winged bean lectin complexed with methyl-alpha-d-galactose

PDB Compounds: (A:) winged bean lectin

SCOP Domain Sequences for d1wbla_:

Sequence; same for both SEQRES and ATOM records:

>d1wbla_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

Timeline for d1wbla_:

• d1wbla_ first appeared (with stable ids) in SCOP 1.55
  
• d1wbla_ appears in SCOP 1.71
  
• d1wbla_ appears in SCOP 1.75
  
• d1wbla_ appears in the current release, SCOPe 2.08