Lineage for d1wbla_ (1wbl A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.1: Legume lectins [49900] (4 proteins) 
Protein Lectin [49904] (15 species) 
Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [49909] (2 PDB entries) 
Domain d1wbla_: 1wbl A: [24052]
Details for d1wbla_
PDB Entry: 1wbl (more details), 2.5 Å
PDB Description: winged bean lectin complexed with methyl-alpha-d-galactose
SCOP Domain Sequences for d1wbla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wbla_ b.29.1.1 (A:) Lectin {Winged bean (Psophocarpus tetragonolobus)}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
SCOP Domain Coordinates for d1wbla_:
Click to download the PDB-style file with coordinates for d1wbla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wbla_:
- d1wbla_ appears in SCOP 1.57
- d1wbla_ appears in the current release, SCOPe 2.08
View in 3D
