| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein automated matches [254646] (36 species) not a true protein |
| Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries) |
| Domain d4m4yd_: 4m4y D: [240519] Other proteins in same PDB: d4m4ya1, d4m4ya2, d4m4yb2, d4m4yc1, d4m4yc2, d4m4ye1, d4m4ye2 automated match to d4n5zb_ complexed with nag; mutant |
PDB Entry: 4m4y (more details), 2.2 Å
SCOPe Domain Sequences for d4m4yd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m4yd_ h.3.1.1 (D:) automated matches {Influenza A virus [TaxId: 641501]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaidgitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnre
Timeline for d4m4yd_: