Lineage for d4m4yb1 (4m4y B:1-174)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646178Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries)
  8. 2646179Domain d4m4yb1: 4m4y B:1-174 [240518]
    Other proteins in same PDB: d4m4ya1, d4m4ya2, d4m4yb2, d4m4yc1, d4m4yc2, d4m4ye1, d4m4ye2
    automated match to d4n5zb_
    complexed with nag; mutant

Details for d4m4yb1

PDB Entry: 4m4y (more details), 2.2 Å

PDB Description: crystal structure of a 2009 h1n1 influenza virus hemagglutinin with a stabilization mutation ha2 e47g
PDB Compounds: (B:) Hemagglutinin HA2 subunit

SCOPe Domain Sequences for d4m4yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m4yb1 h.3.1.1 (B:1-174) automated matches {Influenza A virus [TaxId: 641501]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaidgitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeid

SCOPe Domain Coordinates for d4m4yb1:

Click to download the PDB-style file with coordinates for d4m4yb1.
(The format of our PDB-style files is described here.)

Timeline for d4m4yb1: