![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein Influenza hemagglutinin (stalk) [58066] (8 species) trimer |
![]() | Species Influenza b virus [TaxId:416659] [256362] (1 PDB entry) |
![]() | Domain d4m44f_: 4m44 F: [240517] Other proteins in same PDB: d4m44a_, d4m44c_, d4m44e_ automated match to d1ti8b1 complexed with nag |
PDB Entry: 4m44 (more details), 2.5 Å
SCOPe Domain Sequences for d4m44f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m44f_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza b virus [TaxId: 416659]} ffgaiagfleggwegmiagwhgytshgahgvavaadlkstqeainkitknlnslselevk nlqrlsgamdelhneileldekvddlradtissqielavllsnegiinsedehllalerk lkkmlgpsavdigngcfetkhkcnqtcldriaagtfnagefslptfdslni
Timeline for d4m44f_: