Lineage for d4m44d_ (4m44 D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645923Species Influenza B virus [TaxId:416659] [256362] (1 PDB entry)
  8. 2645925Domain d4m44d_: 4m44 D: [240516]
    Other proteins in same PDB: d4m44a_, d4m44c_, d4m44e_
    automated match to d1ti8b1
    complexed with nag

Details for d4m44d_

PDB Entry: 4m44 (more details), 2.5 Å

PDB Description: crystal structure of hemagglutinin of influenza virus b/yamanashi/166/1998 in complex with avian-like receptor lsta
PDB Compounds: (D:) hemagglutinin HA2

SCOPe Domain Sequences for d4m44d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m44d_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza B virus [TaxId: 416659]}
ffgaiagfleggwegmiagwhgytshgahgvavaadlkstqeainkitknlnslselevk
nlqrlsgamdelhneileldekvddlradtissqielavllsnegiinsedehllalerk
lkkmlgpsavdigngcfetkhkcnqtcldriaagtfnagefslptfdsln

SCOPe Domain Coordinates for d4m44d_:

Click to download the PDB-style file with coordinates for d4m44d_.
(The format of our PDB-style files is described here.)

Timeline for d4m44d_: