Lineage for d4m44b_ (4m44 B:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709417Protein Influenza hemagglutinin (stalk) [58066] (7 species)
    trimer
  7. 1709736Species Influenza b virus [TaxId:416659] [256362] (1 PDB entry)
  8. 1709737Domain d4m44b_: 4m44 B: [240515]
    Other proteins in same PDB: d4m44a_, d4m44c_, d4m44e_
    automated match to d1ti8b1
    complexed with nag

Details for d4m44b_

PDB Entry: 4m44 (more details), 2.5 Å

PDB Description: crystal structure of hemagglutinin of influenza virus b/yamanashi/166/1998 in complex with avian-like receptor lsta
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d4m44b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m44b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza b virus [TaxId: 416659]}
ffgaiagfleggwegmiagwhgytshgahgvavaadlkstqeainkitknlnslselevk
nlqrlsgamdelhneileldekvddlradtissqielavllsnegiinsedehllalerk
lkkmlgpsavdigngcfetkhkcnqtcldriaagtfnagefslptfdslni

SCOPe Domain Coordinates for d4m44b_:

Click to download the PDB-style file with coordinates for d4m44b_.
(The format of our PDB-style files is described here.)

Timeline for d4m44b_: