Lineage for d4m35d_ (4m35 D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1486323Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1486324Protein automated matches [190036] (29 species)
    not a true protein
  7. 1486423Species Mycobacterium smegmatis [TaxId:246196] [188322] (6 PDB entries)
  8. 1486435Domain d4m35d_: 4m35 D: [240514]
    automated match to d4m35a_
    complexed with cl, fe2, mg; mutant

Details for d4m35d_

PDB Entry: 4m35 (more details), 2.05 Å

PDB Description: Crystal structure of gated-pore mutant H126/141D of second DNA-Binding protein under starvation from Mycobacterium smegmatis
PDB Compounds: (D:) Putative starvation-induced DNA protecting protein/Ferritin and Dps

SCOPe Domain Sequences for d4m35d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m35d_ a.25.1.0 (D:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
msarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelv
dfaregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvd
tirrvddavdaedpstadlldglidglekqawlirsenrkv

SCOPe Domain Coordinates for d4m35d_:

Click to download the PDB-style file with coordinates for d4m35d_.
(The format of our PDB-style files is described here.)

Timeline for d4m35d_: