![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (60 species) not a true protein |
![]() | Species Mycobacterium smegmatis [TaxId:246196] [188322] (14 PDB entries) |
![]() | Domain d4m34c_: 4m34 C: [240511] automated match to d4m34a_ complexed with cl, fe2, mg; mutant |
PDB Entry: 4m34 (more details), 2.05 Å
SCOPe Domain Sequences for d4m34c_:
Sequence, based on SEQRES records: (download)
>d4m34c_ a.25.1.0 (C:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} sarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelvd faregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvdt irrvhdavdaedpstahllhglidglekqawlirsenrkv
>d4m34c_ a.25.1.0 (C:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} sarrtiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelvdfar egsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvdtirr vhdavdaedpstahllhglidglekqawlirsenrkv
Timeline for d4m34c_: