| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Mycobacterium smegmatis [TaxId:246196] [188322] (14 PDB entries) |
| Domain d4m33d_: 4m33 D: [240510] automated match to d4m33b_ complexed with cl, fe2, mg; mutant |
PDB Entry: 4m33 (more details), 2.22 Å
SCOPe Domain Sequences for d4m33d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m33d_ a.25.1.0 (D:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
msarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelv
dfaregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvd
tirrvhdavdaedpstadlldglidglekqawlirsenrkv
Timeline for d4m33d_: