Lineage for d1wbfb_ (1wbf B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12495Protein Lectin [49904] (15 species)
  7. 12637Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [49909] (2 PDB entries)
  8. 12639Domain d1wbfb_: 1wbf B: [24051]

Details for d1wbfb_

PDB Entry: 1wbf (more details), 2.3 Å

PDB Description: winged bean lectin, saccharide free form

SCOP Domain Sequences for d1wbfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbfb_ b.29.1.1 (B:) Lectin {Winged bean (Psophocarpus tetragonolobus)}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOP Domain Coordinates for d1wbfb_:

Click to download the PDB-style file with coordinates for d1wbfb_.
(The format of our PDB-style files is described here.)

Timeline for d1wbfb_: