Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
Protein automated matches [190976] (5 species) not a true protein |
Species Artificial gene [TaxId:32630] [233328] (6 PDB entries) |
Domain d4lpwb1: 4lpw B:2-92 [240501] Other proteins in same PDB: d4lpwa2, d4lpwb2 automated match to d4lpwa_ |
PDB Entry: 4lpw (more details), 2.8 Å
SCOPe Domain Sequences for d4lpwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lpwb1 b.1.2.0 (B:2-92) automated matches {Artificial gene [TaxId: 32630]} lpapknlvvsevtedslrlswtapdaafdsfliqyqesekvgeainltvpgsersydltg lkpgteytvsiygvfpyqytmsnplsaeftt
Timeline for d4lpwb1: