SCOPe 2.04: Domain d4lpvb_: 4lpv B:

Lineage for d4lpvb_ (4lpv B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (2 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [233328] (6 PDB entries)

8. Domain d4lpvb_: 4lpv B: [240500]
   automated match to d4lpva_
   complexed with trs

Details for d4lpvb_

PDB Entry: 4lpv, 1.8 Å

PDB Description: Crystal structure of TENCON variant P41BR3-42

PDB Compounds: (B:) TENCON variant P41BR3-42

SCOPe Domain Sequences for d4lpvb_:

Sequence; same for both SEQRES and ATOM records:

>d4lpvb_ b.1.2.0 (B:) automated matches {Artificial gene [TaxId: 32630]}
mlpapknlvvsevtedslrlswtapdaafdsfmiqyqesekvgeainltvpgsersydlt
glkpgteytvsiygvlvvhkltfplsaefttgghh

Timeline for d4lpvb_:

• d4lpvb_ is new in SCOPe 2.04-stable
  
• d4lpvb_ appears in SCOPe 2.05
  
• d4lpvb_ appears in the current release, SCOPe 2.08, called d4lpvb1