Lineage for d4lpvb1 (4lpv B:1-91)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2762239Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2762240Protein automated matches [190976] (5 species)
    not a true protein
  7. 2762241Species Artificial gene [TaxId:32630] [233328] (6 PDB entries)
  8. 2762243Domain d4lpvb1: 4lpv B:1-91 [240500]
    Other proteins in same PDB: d4lpva2, d4lpvb2
    automated match to d4lpva_
    complexed with trs

Details for d4lpvb1

PDB Entry: 4lpv (more details), 1.8 Å

PDB Description: Crystal structure of TENCON variant P41BR3-42
PDB Compounds: (B:) TENCON variant P41BR3-42

SCOPe Domain Sequences for d4lpvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lpvb1 b.1.2.0 (B:1-91) automated matches {Artificial gene [TaxId: 32630]}
mlpapknlvvsevtedslrlswtapdaafdsfmiqyqesekvgeainltvpgsersydlt
glkpgteytvsiygvlvvhkltfplsaeftt

SCOPe Domain Coordinates for d4lpvb1:

Click to download the PDB-style file with coordinates for d4lpvb1.
(The format of our PDB-style files is described here.)

Timeline for d4lpvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lpvb2