SCOP 1.61: Domain d1wbfa_: 1wbf A:

Lineage for d1wbfa_ (1wbf A:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (20 species)

7. Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (2 PDB entries)

8. Domain d1wbfa_: 1wbf A: [24050]

Details for d1wbfa_

PDB Entry: 1wbf, 2.3 Å

PDB Description: winged bean lectin, saccharide free form

SCOP Domain Sequences for d1wbfa_:

Sequence; same for both SEQRES and ATOM records:

>d1wbfa_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

Timeline for d1wbfa_:

• d1wbfa_ first appeared (with stable ids) in SCOP 1.55
  
• d1wbfa_ appears in SCOP 1.59
  
• d1wbfa_ appears in SCOP 1.63
  
• d1wbfa_ appears in the current release, SCOPe 2.08