Lineage for d1wbfa_ (1wbf A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57551Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 57552Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 57553Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 57658Protein Legume lectin [49904] (18 species)
  7. 57827Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (2 PDB entries)
  8. 57828Domain d1wbfa_: 1wbf A: [24050]

Details for d1wbfa_

PDB Entry: 1wbf (more details), 2.3 Å

PDB Description: winged bean lectin, saccharide free form

SCOP Domain Sequences for d1wbfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbfa_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOP Domain Coordinates for d1wbfa_:

Click to download the PDB-style file with coordinates for d1wbfa_.
(The format of our PDB-style files is described here.)

Timeline for d1wbfa_: