| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
| Protein automated matches [190976] (5 species) not a true protein |
| Species Artificial gene [TaxId:32630] [233328] (6 PDB entries) |
| Domain d4lptb1: 4lpt B:2-95 [240495] Other proteins in same PDB: d4lpta2, d4lptb2, d4lptc2, d4lptd2, d4lpte2 automated match to d4lpta_ |
PDB Entry: 4lpt (more details), 2.54 Å
SCOPe Domain Sequences for d4lptb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lptb1 b.1.2.0 (B:2-95) automated matches {Artificial gene [TaxId: 32630]}
lpapknlvvsevtedslrlswtapdaafdsfliqyqesekvgeainltvpgsersydltg
lkpgteytvsiygvlgsyvfehdvmlplsaeftt
Timeline for d4lptb1: