SCOPe 2.05: Domain d4ln8l_: 4ln8 L:

Lineage for d4ln8l_ (4ln8 L:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus [TaxId:1332244] [256359] (9 PDB entries)

8. Domain d4ln8l_: 4ln8 L: [240494]
   Other proteins in same PDB: d4ln8a_, d4ln8c_, d4ln8e_, d4ln8g_, d4ln8i_, d4ln8k_
   automated match to d4n5zb_
   complexed with ca, nag

Details for d4ln8l_

PDB Entry: 4ln8, 2.5 Å

PDB Description: the crystal structure of hemagglutinin from a h7n9 influenza virus (a/shanghai/2/2013) in complex with lstb

PDB Compounds: (L:) Hemagglutinin

SCOPe Domain Sequences for d4ln8l_:

Sequence; same for both SEQRES and ATOM records:

>d4ln8l_ h.3.1.1 (L:) automated matches {Influenza a virus [TaxId: 1332244]}
aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe
lidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr
qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri

Timeline for d4ln8l_:

• d4ln8l_ first appeared in SCOPe 2.04
  
• d4ln8l_ appears in SCOPe 2.06
  
• d4ln8l_ appears in the current release, SCOPe 2.08