![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein automated matches [254646] (36 species) not a true protein |
![]() | Species Influenza A virus [TaxId:1332244] [256359] (11 PDB entries) |
![]() | Domain d4ln8h_: 4ln8 H: [240492] Other proteins in same PDB: d4ln8a_, d4ln8c_, d4ln8e_, d4ln8g_, d4ln8i_, d4ln8k_ automated match to d4n5zb_ complexed with ca, nag |
PDB Entry: 4ln8 (more details), 2.5 Å
SCOPe Domain Sequences for d4ln8h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ln8h_ h.3.1.1 (H:) automated matches {Influenza A virus [TaxId: 1332244]} aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe lidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
Timeline for d4ln8h_: