Lineage for d4ln8h_ (4ln8 H:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970111Species Influenza a virus [TaxId:1332244] [256359] (9 PDB entries)
  8. 1970117Domain d4ln8h_: 4ln8 H: [240492]
    Other proteins in same PDB: d4ln8a_, d4ln8c_, d4ln8e_, d4ln8g_, d4ln8i_, d4ln8k_
    automated match to d4n5zb_
    complexed with ca, nag

Details for d4ln8h_

PDB Entry: 4ln8 (more details), 2.5 Å

PDB Description: the crystal structure of hemagglutinin from a h7n9 influenza virus (a/shanghai/2/2013) in complex with lstb
PDB Compounds: (H:) Hemagglutinin

SCOPe Domain Sequences for d4ln8h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ln8h_ h.3.1.1 (H:) automated matches {Influenza a virus [TaxId: 1332244]}
aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe
lidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr
qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri

SCOPe Domain Coordinates for d4ln8h_:

Click to download the PDB-style file with coordinates for d4ln8h_.
(The format of our PDB-style files is described here.)

Timeline for d4ln8h_: