SCOP 1.75: Domain d1fyub_: 1fyu B:

Lineage for d1fyub_ (1fyu B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (8 PDB entries)
   Uniprot P16404

8. Domain d1fyub_: 1fyu B: [24049]
   complexed with ca, gal, glc, mn

Details for d1fyub_

PDB Entry: 1fyu, 2.6 Å

PDB Description: crystal structure of erythrina corallodendron lectin in hexagonal crystal form

PDB Compounds: (B:) lectin

SCOP Domain Sequences for d1fyub_:

Sequence; same for both SEQRES and ATOM records:

>d1fyub_ b.29.1.1 (B:) Legume lectin {Coral tree (Erythrina corallodendron) [TaxId: 3843]}
vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlyakpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
yqtlgvefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilh
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe

Timeline for d1fyub_:

• d1fyub_ first appeared (with stable ids) in SCOP 1.55
  
• d1fyub_ appears in SCOP 1.73
  
• d1fyub_ appears in SCOPe 2.01
  
• d1fyub_ appears in the current release, SCOPe 2.08