Class b: All beta proteins [48724] (165 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) |
Family b.29.1.1: Legume lectins [49900] (4 proteins) |
Protein Legume lectin [49904] (23 species) |
Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (8 PDB entries) |
Domain d1fyub_: 1fyu B: [24049] complexed with ca, gal, glc, mn |
PDB Entry: 1fyu (more details), 2.6 Å
SCOP Domain Sequences for d1fyub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fyub_ b.29.1.1 (B:) Legume lectin {Coral tree (Erythrina corallodendron) [TaxId: 3843]} vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlyakpvhiw dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns yqtlgvefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilh avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe
Timeline for d1fyub_: