Lineage for d1fyub_ (1fyu B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12495Protein Lectin [49904] (15 species)
  7. 12504Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (7 PDB entries)
  8. 12512Domain d1fyub_: 1fyu B: [24049]

Details for d1fyub_

PDB Entry: 1fyu (more details), 2.6 Å

PDB Description: crystal structure of erythrina corallodendron lectin in hexagonal crystal form

SCOP Domain Sequences for d1fyub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyub_ b.29.1.1 (B:) Lectin {Coral tree (Erythrina corallodendron)}
vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlyakpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
yqtlgvefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilh
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe

SCOP Domain Coordinates for d1fyub_:

Click to download the PDB-style file with coordinates for d1fyub_.
(The format of our PDB-style files is described here.)

Timeline for d1fyub_: