![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein automated matches [254646] (33 species) not a true protein |
![]() | Species Influenza a virus [TaxId:1332244] [256359] (9 PDB entries) |
![]() | Domain d4ln3f_: 4ln3 F: [240485] Other proteins in same PDB: d4ln3a_, d4ln3c_, d4ln3e_, d4ln3g_, d4ln3i_, d4ln3k_ automated match to d4n5zb_ complexed with nag |
PDB Entry: 4ln3 (more details), 2.65 Å
SCOPe Domain Sequences for d4ln3f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ln3f_ h.3.1.1 (F:) automated matches {Influenza a virus [TaxId: 1332244]} aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe lidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
Timeline for d4ln3f_: