Lineage for d4ln3f_ (4ln3 F:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709744Protein automated matches [254646] (27 species)
    not a true protein
  7. 1709806Species Influenza a virus [TaxId:1332244] [256359] (9 PDB entries)
  8. 1709819Domain d4ln3f_: 4ln3 F: [240485]
    Other proteins in same PDB: d4ln3a_, d4ln3c_, d4ln3e_, d4ln3g_, d4ln3i_, d4ln3k_
    automated match to d4n5zb_
    complexed with nag

Details for d4ln3f_

PDB Entry: 4ln3 (more details), 2.65 Å

PDB Description: the crystal structure of hemagglutinin from a h7n9 influenza virus (a/shanghai/1/2013)
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4ln3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ln3f_ h.3.1.1 (F:) automated matches {Influenza a virus [TaxId: 1332244]}
aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe
lidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr
qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri

SCOPe Domain Coordinates for d4ln3f_:

Click to download the PDB-style file with coordinates for d4ln3f_.
(The format of our PDB-style files is described here.)

Timeline for d4ln3f_: